PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG183900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 380aa    MW: 39998.4 Da    PI: 5.346
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG183900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF282.8e-091149341
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                         ien  +r   + +Rr g+  K + L +LC++e++++ f 
  Pavir.5KG183900.1.p 11 IENPKKRRAAYKNRRDGLVQKTSQLATLCGVEALLVCFD 49
                         9**********************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-5163IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.731148IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-14390IPR002100Transcription factor, MADS-box
CDDcd002663.86E-14350No hitNo description
PfamPF003192.9E-121151IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MPRGKLGMQL IENPKKRRAA YKNRRDGLVQ KTSQLATLCG VEALLVCFDP KPAGGAGHDG  60
GAVTTWPGDR EDVLGLIRRY RDTPADKIRH SFTAAAYYQE ELAKQQQKLL KIEQCGPDAL  120
GLEDCRLADL SPADLGALLA ALDETLRKTQ QRIVALGGHV EEDGGDVPPA ATALVGAAAP  180
TPPLPDYSSF DLAFTVPADY AAGSMVTHQY YCPPLDLLSP PVIPLQPPCL AYAYHQMPLP  240
GFTFQMPAPP PPPLMAPLDM GMSGTGTVDF PPPFATNLPH GFYDDFMPGF DATGGGLYVD  300
GGYGAGGGKS FAAAYAGGSY QHEHHLPAGV WPVTVSGLSN DPGPMDAAAA LKERIDFAVL  360
PGSSSSSTST CFQGGFQKK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK4AK501e-151K4AK50_SETIT; Uncharacterized protein
STRINGSi039273m1e-150(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143511825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.15e-11AGAMOUS-like 82